Total number of results for Uranoscopus japonicus are 1
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02439 |
HSDGIFTDSYSRYRKQMAVQKYLAAVLGRRYRQRVRNK
|
38 | Uranoscopus japonicus | Glucagon | Pituitary adenylate cyclase-activating polypeptide | 9213367#Matsuda K., Takei Y., Katoh J., Shioda S., Arimura A., Uchiyama M.#Isolation and structural characterization of pituitary adenylate cyclase activating polypeptide (PACAP)-like peptide from the brain of a teleost, stargazer, Uranoscopus japonicus.# Peptides 18:723-727(1997). |